Protein Info for ABZR87_RS07030 in Ralstonia sp. UNC404CL21Col

Annotation: LON peptidase substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF02190: LON_substr_bdg" amino acids 19 to 213 (195 residues), 113.7 bits, see alignment E=6e-37

Best Hits

KEGG orthology group: K07157, (no description) (inferred from 100% identity to rpf:Rpic12D_0284)

Predicted SEED Role

"Uncharacterized protein, similar to the N-terminal domain of Lon protease" in subsystem Proteasome bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABZR87_RS07030 LON peptidase substrate-binding domain-containing protein (Ralstonia sp. UNC404CL21Col)
MQEDIALSPFSPLPPLPTELPLFPLHTVLFPGGLLPLRIFEARYMDMVRTCLRDKTPFGV
CLIERGNEVGTTDNPTVPVDVGCIAHITECDMEQLGLLMIKVRGTQRFKVLSFETTPNGL
MRGTVEPIGADVEDCKGELFDDCVGALRRIITTLGSREDGNVPMVEPYEWNSPSWVANRL
CELLPVPLKAKQKLMELMDAGMRIEIVHRYMKQHHIL