Protein Info for ABZR87_RS06895 in Ralstonia sp. UNC404CL21Col

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 75 to 269 (195 residues), 246.8 bits, see alignment E=7.9e-78 PF00528: BPD_transp_1" amino acids 109 to 277 (169 residues), 79.5 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 48% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to rpi:Rpic_0236)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABZR87_RS06895 nitrate ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MNTLVKTLSGVQSDAAPERRRFVARDWFVAAVVRGFPPVLGLVLFVLAWQGIATAISALP
TPAVTWKAAVALFADPFYRNGPNDQGVGWNVLASLARVGAGFGMAAVIGIPAGFLIGRFA
FLNAMASPIISLLRPVSPLAWLPIGLLLFKSANPAAIWAIFICSIWPMVINTAVGVTRVP
QDYLNVARVLNLSEWKVFTRVLFPAVLPYMLTGVRLSIGTAWLVIVAAEMLTGGVGIGFW
LWDEWNNLKVEHIVIAIFVIGVVGLLLEHALLAIARRFSYDAV