Protein Info for ABZR87_RS06860 in Ralstonia sp. UNC404CL21Col

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 972 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 503 to 522 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 551 to 674 (124 residues), 43.6 bits, see alignment E=3e-15 PF08448: PAS_4" amino acids 562 to 668 (107 residues), 56.2 bits, see alignment E=7.5e-19 amino acids 685 to 803 (119 residues), 31.7 bits, see alignment E=3.2e-11 PF13426: PAS_9" amino acids 571 to 666 (96 residues), 28.9 bits, see alignment E=2.3e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 808 to 970 (163 residues), 144.1 bits, see alignment E=3.3e-46 PF00990: GGDEF" amino acids 813 to 969 (157 residues), 145.9 bits, see alignment E=1.9e-46

Best Hits

KEGG orthology group: None (inferred from 95% identity to rpf:Rpic12D_0250)

Predicted SEED Role

"FIG00973913: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (972 amino acids)

>ABZR87_RS06860 diguanylate cyclase (Ralstonia sp. UNC404CL21Col)
MVPRRPLVAIAGGIGFLLVLVGLTVMVGWLRHWPWAVKVGTDRLLIVFATGINLTLLGVG
LTALLVGTVRPNVRWADPVARGLGGVVAVLSTLRMAEMITGWPIGLDFPAVHTWLDRQWV
TGWIGGMHPSHALAMAASATALSLVPTLRKPHRARWFWGLVGLAMLLCAGDLLGRAMALE
YLYPTWLVWRASDVAAICTLLVVTGVLCLAVIRQPGMLRLRLSPEDTIVWISGGCVVLAG
LGATITAFIIQVDSVSQTFGTTRTRALSSYAEEFDQLLAMRAESPRLVAAATHIQEVLRH
PADNAARLRSESALQAYREQGYSYLQLRTLAGEGIVSLGTQTPKPELSIPLHAGLPPERV
TLQWVHGFAMRTETPVMADGMQIGWLVAEQPLAHMTARYATERGIGKTETLAMAGLDARG
RAMSFPQRFDAYVFELPALTLDRRPLPSRLALAGEAGYGQWQDIHGMPTSFSYTPIGHTG
LALISKIACAELYAPMRVQFERLAAFMLCLMIGSVLVIRLTVRPFANRLAASERALRTAN
ESLERRRDALRASREQLRLVADNVPAQLSYVDPDGIVRFASRTLLEAFGRREDEMLDRHV
RDIYAPEDYRALLPYMTEVLAGYPVQFEIQSMRTGVPRYLSGHYFPDYDDRGTLRGYFSV
LQDLTARTAAELALARSERALKLVLDNAPLLVSHINPDGVFTFCNVTHARWLQRTPEDVC
GQTPEHVFTPGTYALLAPYLARAQRGESVQFEITAPWYEKPSASGLRSRSRHFRGQLVPD
AGEAQDGRCGFYAFVQDVTEAKRSEMELSRMARFDALTGLPNRYELYERLRGALERRQRL
PAPLGVLYLDVDHFKHINDTYGHAAGDAVLVEVAHRLQRAVRRTDTVARLAGDEFIILLD
PIDAPDDALHTAQKIVGAIRPPIILPGDTILHVTTSIGVACPGPEVREPDAALREADRAL
YWAKSRGRNTAA