Protein Info for ABZR87_RS06855 in Ralstonia sp. UNC404CL21Col

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR02392: alternative sigma factor RpoH" amino acids 34 to 306 (273 residues), 411.7 bits, see alignment E=1.6e-127 PF00140: Sigma70_r1_2" amino acids 36 to 65 (30 residues), 32 bits, see alignment (E = 1.5e-11) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 68 to 304 (237 residues), 109.1 bits, see alignment E=1.7e-35 PF04542: Sigma70_r2" amino acids 73 to 142 (70 residues), 73.4 bits, see alignment E=1.6e-24 PF04545: Sigma70_r4" amino acids 247 to 302 (56 residues), 52.4 bits, see alignment E=4.6e-18

Best Hits

Swiss-Prot: 54% identical to RPOH_VIBCH: RNA polymerase sigma factor RpoH (rpoH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to rpf:Rpic12D_0249)

MetaCyc: 54% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABZR87_RS06855 RNA polymerase sigma factor RpoH (Ralstonia sp. UNC404CL21Col)
MNAVIPVNTVSAIATQPSGNAGNGWALAFPGNLGNIDAYIQSVNRVPMLSAEEEQRLARE
YRDNDNLDAARRLVLSHLRLVVSIARGYLGYGLPHADLIQEGNIGLMKAVKRFDPDQGVR
LVSYAMHWIKAEMHEYILKNWRMVKVATTKAQRKLFFNLRSHKQDAQATFTSDEIDAVAA
ELNVKGTEVREMETRLSGGDIALEGQMDDGEESFAPIAYLADTHNEPTRVIEARSNDRMQ
SEGIEAALAKLDDRSRRIIEARWLNVNDDGSGGSTLHELADEFGVSAERIRQIESAAMKK
MKGALQAFA