Protein Info for ABZR87_RS06850 in Ralstonia sp. UNC404CL21Col

Annotation: SCO family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02630: SCO1-SenC" amino acids 43 to 177 (135 residues), 161.9 bits, see alignment E=8.3e-52 PF00578: AhpC-TSA" amino acids 45 to 179 (135 residues), 45 bits, see alignment E=9.9e-16

Best Hits

Swiss-Prot: 32% identical to SCO22_RICBR: SCO2-like protein RBE_0699 (RBE_0699) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K07152, (no description) (inferred from 98% identity to rpf:Rpic12D_0248)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>ABZR87_RS06850 SCO family protein (Ralstonia sp. UNC404CL21Col)
MLSFRHLRAALFAMLAVAMLALAACSDKPAFKNLDITGSKSFGTDFSLTDHTGKRRTLED
FRGKVVVMFFGYTHCPDVCPTTLAELRAVMDTLGKDADRVQVLFVTVDPERDTQDLLAKY
VPAFDPRFIGLRPANETELKKVASDFKVFYSKVPGSSPDNYTMDHTAGSYMFDPKGNLRL
FIKHGQGPEPIAHDIKQLLAD