Protein Info for ABZR87_RS06840 in Ralstonia sp. UNC404CL21Col

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details PF02628: COX15-CtaA" amino acids 31 to 341 (311 residues), 292.6 bits, see alignment E=1.7e-91

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 97% identity to rpi:Rpic_0227)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>ABZR87_RS06840 COX15/CtaA family protein (Ralstonia sp. UNC404CL21Col)
MLLQLASIGILIALIPLCYVLVKGDRNKYRKLVWITAFLTLDLIMFGSFTRLTDSGLGCP
DWPGCYGTSNPFHARDDIHAAQAAMPSGPVTWMKAWIEMTHRYFALALGVLIITLVVLAW
VKRKELKQSPWYATAVLALVCVQGAFGAWTVTLKLQPAIVVTHLLLGMSLLAALIWLGCK
NDVPRVVDERGASLRMAAAIGLALLVVQIALGGWVSTNYAVLACTDFPLCNGQWVPPMDF
AHGFTFWRQLGKTAGGDFISHDALVAIHWTHRVFAVVVLSYLAWLGVRARRIDGIGRVAT
VLLVVLAVQLATGLSNIVLGWPLLAAVAHNGGAAVLLLLMVRLHYLIGLAQARAPMPVAA
AVV