Protein Info for ABZR87_RS06800 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details amino acids 204 to 231 (28 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details amino acids 472 to 494 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 30 to 532 (503 residues), 704.9 bits, see alignment E=2.9e-216 PF00115: COX1" amino acids 38 to 478 (441 residues), 542.8 bits, see alignment E=3.2e-167

Best Hits

Swiss-Prot: 57% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to rpi:Rpic_0219)

MetaCyc: 71% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (534 amino acids)

>ABZR87_RS06800 cytochrome c oxidase subunit I (Ralstonia sp. UNC404CL21Col)
MSTAVTHPQDHAHGHGDDHAHDHPHGWRRWLFATNHKDIGTLYLLFSFMMLLSGGTLALL
IRLELFQPGLQFFHPELFNQFTTLHGLIMVFGAIMPAFVGFANWMIPLQVGASDMAFARM
NNFSFWLLPPAALLLVGSFFAPGGATAAGWTLYAPLSVQMGPGMDMAIFAVHIMGASSIM
GAINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMPVLAGAITMVLTDRHFGTSF
FSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQIVPAFARKPLFGYSSMVYATASI
AILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTGVKIFNWVATMWRGSMTFETPMLF
AIGFIFVFTVGGFTGLILAVAPIDIQLQDTYYVVAHFHYVLVAGSLFALFAGFYYWGPKW
SGYMYSETRGKIHFWGSMITFNLTFFPMHFLGLAGMPRRYADYPQQFADFNAIASIGALG
FGLMQVYFFFFVVLPSYRGGEKAADKPWDGAEGLEWTVPSPAPFHTFEEPPLVK