Protein Info for ABZR87_RS06785 in Ralstonia sp. UNC404CL21Col

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF13489: Methyltransf_23" amino acids 39 to 168 (130 residues), 40.7 bits, see alignment E=5.1e-14 PF13847: Methyltransf_31" amino acids 50 to 165 (116 residues), 46.9 bits, see alignment E=6.3e-16 PF08242: Methyltransf_12" amino acids 52 to 159 (108 residues), 41.4 bits, see alignment E=5e-14 PF13649: Methyltransf_25" amino acids 52 to 157 (106 residues), 57.1 bits, see alignment E=6e-19 PF08241: Methyltransf_11" amino acids 52 to 161 (110 residues), 68.2 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 97% identity to rpi:Rpic_0216)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABZR87_RS06785 methyltransferase domain-containing protein (Ralstonia sp. UNC404CL21Col)
MSDPVLARPAALRRAFDRRAARFADVDFLLREVGSRMQDRLSYIKAMPARALDLGCGLGQ
GLAVLRAQYPDAQICGVDWSSAMLAQAQKLDPQRTDAGWLGRLLKKRPVFDFAQADFRAL
PFAGASFDLLWSNLALHWDPAPHAIFPEWHRITTEGGLLMFSLFGPDTLRELRSALAGID
AGIHTLRFVDMHDIGDMLVHSRWSTPVMDMEQITITYETPQALLADVHLLGGMAGLTDDA
GRSLAGAGLHTPRWRQRLFDALDAQRNPDGVIPLTFEIVYGHAWKLAPTQRQALDDQGRA
MIPIDQIGRKPRA