Protein Info for ABZR87_RS06745 in Ralstonia sp. UNC404CL21Col

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF22694: CtpB_N-like" amino acids 30 to 87 (58 residues), 38.4 bits, see alignment 3.6e-13 TIGR00225: C-terminal processing peptidase" amino acids 53 to 384 (332 residues), 323.6 bits, see alignment E=6.7e-101 PF00595: PDZ" amino acids 102 to 168 (67 residues), 41.3 bits, see alignment E=4.1e-14 PF13180: PDZ_2" amino acids 102 to 179 (78 residues), 54.3 bits, see alignment E=3.4e-18 PF17820: PDZ_6" amino acids 119 to 170 (52 residues), 42.6 bits, see alignment 1e-14 PF03572: Peptidase_S41" amino acids 200 to 381 (182 residues), 176.8 bits, see alignment E=6.6e-56

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 98% identity to rpi:Rpic_0208)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>ABZR87_RS06745 S41 family peptidase (Ralstonia sp. UNC404CL21Col)
MRTSLKNISLIAIGLVTGVLATLQLSATAQNATVGPLPLEKLRLMADIFGQIKREYVEPV
DDDKLLTEAIKGMVASLDPHSAYLDKKDFQELQEGTQGRFAGLGIEISQEEGLVKVINPI
EDTPAFRAGVQPGDLITRIDDKPVRGMPLEQAVKRMRGAPGTKVTLTIYRKKEERTFPLT
ITRAEIQVQSVKAKMLDNGIAWVRITSFQERTVPDLAKKLNDLAKQDAHLKGLILDLRNN
GGGVLQAAVGVSAAFLPPDVTVVSTNGQVPDAKRTYKATFANYRLSNFDSDPLANLDPEF
KTVPIIVLTNAYTASASEIVAGALQDHHRAKTMGKTTFGKGSVQTVRPLSNDTGIKLTIA
YYYTPSGKSIQAKGIRPDIPVDQNPDGDPDDALITREIDTERHLHNKQESEEAEMTEREK
RRVEELRRLEEENAKKTPEQREKERNKKPIEFGSAEDFMLQQAIADLKGQPVKRSKSVLE
AAAAAVPDKAVKSPAAKESSAPAKLPKGKAAPASEPAAPKPNVPASGVQPAPEPTGAR