Protein Info for ABZR87_RS06535 in Ralstonia sp. UNC404CL21Col

Annotation: VanZ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF04892: VanZ" amino acids 34 to 139 (106 residues), 42.7 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0179)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABZR87_RS06535 VanZ family protein (Ralstonia sp. UNC404CL21Col)
MTDFHSQPAAPTSHRHSPLARAGLGWFVLLVVYASLYPFAGWTDTGVSPFAFLSAPLPRY
NTGFDMLTNVWGYMPLGMLTVLALHPRITGWRAALLALLAGLLLSGAMEAIQTYLPTRVS
SNVDLATNTLGALLGGIVMLPFSARLIDRGGLRRLRRRWFEPHATFAILLMLVWPFAQIF
PQEFLFSMGGVIRSILLDPSPDAFVVNLLNGWFPELFDWQDKLTAHPEALQRQELLEALI
TACSWIGTGLLASVAMRRGAPMLRLLAALLAGALLVKAGATVLQFPLGGAWDWLSSGARF
GLVVGSLVLVLLVRLPRWLRGALAMTLLIALIILSNVLPPSPYSWVSAQSWRLGRFVHFN
SLSQWIGWLWPFLGLGYLAWRAEQTQLQRRAGRQAR