Protein Info for ABZR87_RS06265 in Ralstonia sp. UNC404CL21Col

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 35 to 330 (296 residues), 414.8 bits, E=1e-128
• PF04055: Radical_SAM
  • amino acids 68 to 226 (159 residues), 87.1 bits, E=1.6e-28
• PF06968: BATS
  • amino acids 240 to 330 (91 residues), 105.7 bits, E=1.1e-34

Best Hits

Swiss-Prot: 98% identical to BIOB_RALPJ: Biotin synthase (bioB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 98% identity to rpi:Rpic_0117)

MetaCyc: 66% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (359 amino acids)

>ABZR87_RS06265 biotin synthase BioB (Ralstonia sp. UNC404CL21Col)
MQSTPLNFVPNAAKVPPTPGQNPNARWSREAIEALFALPFNDLLFQAQQVHRANFDANAV
QLSTLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEAASRAKQNGASRFCMGA
AWRNPKPHQLDAVADMVRGVKAMGLETCVTLGMLKQEQAAQLKEAGLDYYNHNLDTAPEF
YGEIITTRTYQDRLDTLEHVREAGINVCCGGIVGLGESVHERAGLIAELANMEPYPDSVP
INNLVKVEGTPLAGNEELDPFDFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAG
ANSIFYGEKLLTTDNPEADADRKLLARLGMRVEVQDHMHHEAHAGAHSSHCHIDITPAD