Protein Info for ABZR87_RS06180 in Ralstonia sp. UNC404CL21Col

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF08238: Sel1" amino acids 49 to 83 (35 residues), 26.6 bits, see alignment 3.3e-10 amino acids 84 to 118 (35 residues), 24.4 bits, see alignment 1.7e-09 amino acids 123 to 155 (33 residues), 23.9 bits, see alignment 2.5e-09 amino acids 159 to 191 (33 residues), 20 bits, see alignment 4.1e-08

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 91% identity to rpi:Rpic_0100)

Predicted SEED Role

"FOG: TPR repeat, SEL1 subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>ABZR87_RS06180 tetratricopeptide repeat protein (Ralstonia sp. UNC404CL21Col)
MPADAATATAAVAATADAAVVDAIHAVLTGPADRAARWLAAAAQRGHTEAQAIFGQWLLD
GRGVKRNPGEALFWFKTAALSGHAMAANMLGRCYEHGWGTPACDKTATHWYARAADAGLD
WGQYNYATQLQLGRGIPADRARAFALFQAAAAQGHAKSINVLGGFYEDGWEVEADPAMAL
RCYVRAAEGGDFRGQFNAARLLALANRPDEALTWMQAVPRTATPAFLAKAHDFLAGHPDA
RLRALACVLNTPSPCC