Protein Info for ABZR87_RS06175 in Ralstonia sp. UNC404CL21Col

Annotation: Fe2+-dependent dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF13640: 2OG-FeII_Oxy_3" amino acids 84 to 176 (93 residues), 55.5 bits, see alignment E=9.4e-19 PF18331: PKHD_C" amino acids 183 to 226 (44 residues), 64 bits, see alignment 1e-21

Best Hits

Swiss-Prot: 74% identical to Y5206_BURPS: PKHD-type hydroxylase BPSS1206 (BPSS1206) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 96% identity to rpi:Rpic_0099)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>ABZR87_RS06175 Fe2+-dependent dioxygenase (Ralstonia sp. UNC404CL21Col)
MLLKIPAVLTKEQVAHCRATIDAAEWVDGKVTAGAQSGQVKHNMQLPEGSPAARKVGTLI
QDALSANTLFFSAALPLKVFPPLFNRYAGGQTFGNHVDNAVRHLRGTDFRIRSDLSCTLF
LSEPEDYDGGELIIDDTFGEHRVKLAAGDMVLYPSSSLHRVTPVTRGARVCSFFWLQSMV
RSDAHRTLLFQMDTELQRLMGLLGQDDSSVIALTGTYHNLLREWAEA