Protein Info for ABZR87_RS06025 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF00892: EamA" amino acids 25 to 159 (135 residues), 53.5 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 95% identity to rpf:Rpic12D_0090)

Predicted SEED Role

"FIG006442: Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>ABZR87_RS06025 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MAVGDTSTATQLHHGQHDARRDHLTGIGYGVAAGALWGVIFVAPKMLPQFSPLALSAARY
VLYGVLSLALALPVWRTLWRKTNRRDWAALLLLSLPGNILYYLCVAGGVQRAGVAPVSLI
VGLLPVTVTLAGAAERGSLPLRQLAVPLLMAVAGVVCIYLDAPHVHSDAGGRTYFIGLLM
AAGALACWTVYAVCNARYLRVRPQFTSREWSLLTGVATGVLSLALAVPAFLLPGMATASA
QPASAWAMFWLVNMGVALGASVLGNSLWNAASRKLPLTLSGQLIVFETVFALVYGFVYEG
RLPHGLEVVAGVLLVSGVGLAARRHG