Protein Info for ABZR87_RS06015 in Ralstonia sp. UNC404CL21Col

Annotation: low temperature requirement protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 341 to 357 (17 residues), see Phobius details amino acids 362 to 379 (18 residues), see Phobius details PF06772: LtrA" amino acids 18 to 377 (360 residues), 376 bits, see alignment E=1.1e-116

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_0079)

Predicted SEED Role

"Bll5714 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>ABZR87_RS06015 low temperature requirement protein A (Ralstonia sp. UNC404CL21Col)
MPRSYLRPSPEGAHGHHRVTNIELFFDLVFVFAVTQLSHLLIGNFTLQGGAQALLLMLAV
WWVWIFTSWVTNWLDPDKLAIRMLMLVLMTGGLLLSASLPQAFGSRGLAFALAYVFMQFG
RTVFFLWAVRGEALPMRRNFQRIATWLGISAVLWLAGGLSDGSVRWACWIVALAIEWVGP
SMGFYTPGLGRSTTNDWNVEGGHMAERCSLFIIIALGESVLVTGSTFAGLDWTAQNIAAM
ALSFIGSLAMWWLYFDTIAERGAHTMSHSADPGRLARLAYTYIHVVLVAGIIVGAVADEF
VLAHPVGHPHAGTALAVLGSAALYLLGNLLFKWAIFGRLRPAHVVGLVALGGAWMVAGEW
PALAVSALATGVLCGTAAWEGYARSCETAEPAQAHGH