Protein Info for ABZR87_RS06005 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 361 to 377 (17 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 346 (339 residues), 145.2 bits, see alignment E=1.2e-46

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_0077)

Predicted SEED Role

"FIG00977464: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>ABZR87_RS06005 MFS transporter (Ralstonia sp. UNC404CL21Col)
MPASLWWLCLGAFAIGTEGFMIAGLLPVLAADLGVSVPAAGQLVTVFAVTYAVGSPVMAA
LLGNVDRRRVLIGALAIFAAGNLLAATAHGFGQLMAARVLLALAAGVFLPTANAVATSLV
PASRSGSALAIITGGGTVAVALGVPLGAWIAAQGDWRSTFIACGVLSALATAGLAFGLPR
ALPHSVTTLAQRLSVARRPGMLGALAVSTLWAAGGFTFYTYVAPFFVQGLGFAPQHVGIV
LFLVGSFAALGTGLGGHMTDRAGVARVLAVSSAGIVLAFSVLSLSAQVLHGTVAGAVAIG
AVVLWGMAGWGFGPAQATRLIRLAPDVSPITLSLHASAVYVGIALGSSVGALALAHGGPG
MLGWAAAACHVVAVVLWRRGGRHEAALADEPAATSVAH