Protein Info for ABZR87_RS05900 in Ralstonia sp. UNC404CL21Col

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 269 to 293 (25 residues), see Phobius details PF02743: dCache_1" amino acids 90 to 256 (167 residues), 62.8 bits, see alignment E=5.6e-21 PF00672: HAMP" amino acids 296 to 343 (48 residues), 41.8 bits, see alignment 1.6e-14 PF00015: MCPsignal" amino acids 409 to 562 (154 residues), 172.8 bits, see alignment E=9.2e-55

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 73% identity to bgl:bglu_2g09390)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>ABZR87_RS05900 methyl-accepting chemotaxis protein (Ralstonia sp. UNC404CL21Col)
MLSSIRARVVCACVSLVAFSVVSTTVANYTTAKASAEAAIDHDLTTYADDHAKAIGDWIA
AKTLMVSSLQDAVLTTNPDPMLKQIAVAGGFFDVGVGYPDRTAKFTDWPNIPASYDPTSR
PWYKGAAQAGKSVAIPYVSTSGQLLVALAVPVIRDGVLKAVLVGDVALDSVVENVKSIHP
TPASFGVLVDQSGRVIAHPDPKLRFKPVADIAPDFAKVATTSGSTGKVPMELTVDGKAKL
MRAQAVAGTDWHVVVSLDKSEATAGIRSLLTASLISLFIIVGIATVVCFAITTTVFRRLA
EVCHAMAAIGSGTGDLTQRLPEGGRDEVADIARSFNQFVAKLQKVMLEIRGASELVHAAA
NEIAAASLDLSSRTESAAASLQQTAASMDEISGTVVQSGAAAREADARSVTATQTASQGG
EAMSNVIGTMTTIEEASDRIGTIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAQ
EVRGLAHRSAQAAREIKQLVESTVASVAAGAAQVHQAGDTMSEIVTNVAQVQSIVSDIAR
SATEQMAGIQEVNRAVAQLDEMVQQNAALVEESAAASSALQNQADALVSAIGQFKID