Protein Info for ABZR87_RS05890 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 107 (98 residues), 92.4 bits, see alignment E=1.1e-30 PF00528: BPD_transp_1" amino acids 32 to 212 (181 residues), 95.3 bits, see alignment E=2e-31

Best Hits

Swiss-Prot: 38% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 88% identity to bgl:bglu_2g09480)

MetaCyc: 38% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ABZR87_RS05890 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MRWSDVVEFVPILLKGAGISVFITISCLLLSTALGLVWALLKMSRFAAVRRAVATLINVV
RGLPMIVLLFYIYFVFPDIHLRLDALEASIVGLAFGYSTYVAEIIRSGIESVDPGQYEAA
QSLGMGKVKTMTRVILPQAIKVALPPYSNTLVSMLKDSSLASTITVAEMTREGSLIAAAT
FQNLTVYTLVAIGYLALSLPLMGLTRHLERRFGKHKVK