Protein Info for ABZR87_RS05840 in Ralstonia sp. UNC404CL21Col

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 6 to 328 (323 residues), 374.8 bits, see alignment E=2.1e-116 PF04166: PdxA" amino acids 36 to 325 (290 residues), 353.7 bits, see alignment E=4.2e-110

Best Hits

Swiss-Prot: 61% identical to PDXA_BEII9: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 60% identity to axy:AXYL_01844)

MetaCyc: 48% identical to 4-phospho-D-tetronate 3-dehydrogenase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-18600 [EC: 1.1.1.408]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.262

Use Curated BLAST to search for 1.1.1.262 or 1.1.1.408

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>ABZR87_RS05840 4-hydroxythreonine-4-phosphate dehydrogenase PdxA (Ralstonia sp. UNC404CL21Col)
MKQKLIAVTMGDAAGIGPEIIVKTFANAALCVEQPSFVIGDAGVLRRQAAALDVQLTIRE
VNSVAEVAPEPGVLEVLQVPGSAALPENLAVGEVSAAAGQAAFDAIRMAIELAVRGDIAG
ICTAPIHKEALGAAHVPYPGHTEMLADLSGTRDYAMMLVNPTLRTILVTVHCSMLDAIAK
LSVESELRIIRLAHRAMRDLGIERPRVAVAGLNPHAGEGGLFGREDLDIIAPAIRLAQAE
GIDASGPWPGDTVFMNASRGRFDIVVAQYHDQGLIPVKLAGVEDGVNITVGLPFVRTSPD
HGTAFDIAGKGIADPASLQLALRTAHQFVRPQAGHTFSTGA