Protein Info for ABZR87_RS05660 in Ralstonia sp. UNC404CL21Col

Annotation: ornithine--oxo-acid transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01885: ornithine--oxo-acid transaminase" amino acids 11 to 399 (389 residues), 468.1 bits, see alignment E=1e-144 PF00202: Aminotran_3" amino acids 16 to 399 (384 residues), 380.1 bits, see alignment E=5.7e-118

Best Hits

Swiss-Prot: 53% identical to OAT_BORPA: Ornithine aminotransferase (rocD) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K00819, ornithine--oxo-acid transaminase [EC: 2.6.1.13] (inferred from 98% identity to rpi:Rpic_0052)

MetaCyc: 45% identical to ornithine-delta-aminotransferase (Arabidopsis thaliana col)
Ornithine aminotransferase. [EC: 2.6.1.13]

Predicted SEED Role

"Ornithine aminotransferase (EC 2.6.1.13)" in subsystem Arginine and Ornithine Degradation or Dimethylarginine metabolism (EC 2.6.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABZR87_RS05660 ornithine--oxo-acid transaminase (Ralstonia sp. UNC404CL21Col)
MTTAMQHPSYALEDRYGARNYAPLPVMLERGEGVWLFDTDGRRYLDMMSAYSAVSFGHSH
PKLVAALIEQAGRLTLTSRAFHNVELGPFLADVCRITRMDRALPMNTGAEAVETAIKAAR
KWARDVKGLAPEAAEIIVFENNFHGRTTTIVGFSSHDQYRYGFGPFAAGFRRIPFGDADA
LRAAIGPNTGAILMEPVQGEGGIVEPPPGYLKLARELATRHNVLLICDEVQTGLGRTGDV
LASWHEGVDADLVVLGKALGGGMVPVSAIAGREAVIGVFRPGDHGSTFGGNPLAAHIGRA
ALALLMEEQLPQRAARVGAAFINELKTLVGHGVRQVRGRGLLIGLQLDADIDAHDFAFAL
AERGVLTKDTNGNVVRLTPPLVIGEAELALALEAIRQTLAGWPRRKVA