Protein Info for ABZR87_RS05515 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 40 to 57 (18 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 296 to 322 (27 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details PF07690: MFS_1" amino acids 48 to 410 (363 residues), 146.3 bits, see alignment E=5.8e-47

Best Hits

KEGG orthology group: None (inferred from 55% identity to rsc:RCFBP_11079)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>ABZR87_RS05515 MFS transporter (Ralstonia sp. UNC404CL21Col)
MNPHPHAGALAQPAPAAATPSALPRTAPDDPALDAIYRRIAWRLMPILLLAQVLAYLDRV
NIGTAKLQMAADLSLSATAYGLGAGIFFVGYFFFEVPSNLLLHRLGARSWIARIMVSWGL
LSAAMGWVQSTTGFYVLRFLLGVAEAGFFPGIVLYLTYWFPAHRRGRMTTLFMSATAVAG
IVGGPLSGWILAAFDGQLGHAGWRWMFVLEGLPSALVGVLVFFLLPSRPREVRWLSADAL
AHLEADLAQAAPAQAPLHRASDILNGTVLLFALIYFLLLAGLYGVSFWLPSVIRAAGIAS
TVTVGWLSAVPYAVAMVAMNVVARQADRRRNWGTLVGACALVAGAGFCVSAFTVDQLAPA
MAALTVASAGILSALPLFWNLPTARLDGVAAAAGIGFINAIGNLSGFVSPFAIGWLTDLT
HTATAGVGLLGACAMLAGVLTLAYGRRSRAS