Protein Info for ABZR87_RS05460 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 111 (97 residues), 88.5 bits, see alignment E=1.8e-29 PF00528: BPD_transp_1" amino acids 47 to 216 (170 residues), 73.2 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to rpi:Rpic_0018)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>ABZR87_RS05460 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MAYQFDFGAVFSYSGQLAQGAAFTLALTAAGAVLGGAIGIAGGVCRAWRIAPFNALFKVY
VEGIRNTPFLVQLMFVFFGLPSLGVQINEWQAALLTAVVNLGAYITEIVRAGIQETPRGQ
LEAANALAMSRWAIFRHVVLRPALQKVWPALSSQIVIVMLGTSVVSQIAAQDLTFAANFI
QSRNFRAFETYLVVTALYFALALLLRQLLAWIGQRFVVGRRAPAASAAPLAATATAAASV
GDAA