Protein Info for ABZR87_RS05440 in Ralstonia sp. UNC404CL21Col

Annotation: ShlB/FhaC/HecB family hemolysin secretion/activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF08479: POTRA_2" amino acids 79 to 151 (73 residues), 67.3 bits, see alignment E=1.3e-22 PF17287: POTRA_3" amino acids 152 to 206 (55 residues), 42.1 bits, see alignment 6.9e-15 PF03865: ShlB" amino acids 211 to 523 (313 residues), 303 bits, see alignment E=4.7e-94

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_0014)

Predicted SEED Role

"cell processes; transport of large molecules; protein, peptide secretion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>ABZR87_RS05440 ShlB/FhaC/HecB family hemolysin secretion/activation protein (Ralstonia sp. UNC404CL21Col)
MLSAVSRAAALYVGTLSSLALAQVAPAPLTGPGPEVQRLQEQQAEQARERANARPDVFTL
PAPAQVISLSALPKETPCFQINGITLEDNVFWWLPDLLKPVNGQCVGKQGLEAIELQANN
ALIERGYVTSRVLIPKQNLAGGTLQLKVLAGRIGAIRNASDDNIGWARMVLLAGPGDLLN
QRDLDQALESIRRLPGQSQTSFDIVPGERVGESDIVLKPGTDKRWHASLSADNTGLKSTG
KYQMSGSLVIDSPLHLYDQLSISASSNTDRGSTAAGTRSYSINWSVPVGYATLFVGANRS
RYNQTVAGFEEPIVYSGNSSEVNAGISGVLHRDATSRTGAQFKLFRKINRNYLEDTEIAV
QRRDVVGYEASMSHRHYLGPVVLDGGFAWRETLPDHSNVPGVVVGDPGYGGRSQVETANA
SLYWPFKLANQMFEYTSNWSIQHARTRVLPSDYFTIGNRYTVRGFDGQLTLAAEDGWFWR
NELAWRVAGQAVYAGVDMGKVHGPSAEFLLGDKLVGAVVGVRGRVPSGPYMAFNYDVSFG
WPLYKPAGFRSQQPAVMAQVGVEF