Protein Info for ABZR87_RS05350 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF10396: TrmE_N" amino acids 26 to 142 (117 residues), 136.3 bits, see alignment E=1.2e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 30 to 481 (452 residues), 326.8 bits, see alignment E=2.6e-101 PF12631: MnmE_helical" amino acids 145 to 478 (334 residues), 195.9 bits, see alignment E=1.9e-61 PF01926: MMR_HSR1" amino acids 240 to 362 (123 residues), 91.2 bits, see alignment E=1e-29 TIGR00231: small GTP-binding protein domain" amino acids 240 to 369 (130 residues), 72.8 bits, see alignment E=2.7e-24 PF02421: FeoB_N" amino acids 240 to 329 (90 residues), 40.1 bits, see alignment E=5.3e-14

Best Hits

Swiss-Prot: 93% identical to MNME_RALSO: tRNA modification GTPase MnmE (mnmE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 98% identity to rpf:Rpic12D_3456)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>ABZR87_RS05350 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Ralstonia sp. UNC404CL21Col)
MTAADHPTALPNASTAPRAPILTIPIAAIATAPGRGGIGVVRVSGPDVRAVMQAVCGRVL
TPRQATYLPFLDADGNAIDRGIALWFPAPHSYTGEDVLELQGHGGPVVMQLLLQRCLDAG
REIGLRVAEPGEFTRRAFLNDKMDLAQAEAVADLIEASTEAAARSAARSLDGAFSQAVHA
LVERVIHLRMLVEATLDFPEEEIDFLEASDARGQLADIRAAVDGVLAQARQGALLREGLH
VVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVQQTIQIEGIPLNIVDTAGLRDTE
DEVERIGIERTWAAIARADVVLHLLDAADYRANGLSPEDAAIDARIAEHVPAGVPTLRVI
NKIDLSGVAVPGRVDAEPPEVWLSARDGLGVELLRAALLEIAGWQGGGEGLYLARERHLA
ALRTAREHLATAAEHAAQQAQSLDLFAEELRLAQEALNSITGAFSSDDLLGVIFSRFCIG
K