Protein Info for ABZR87_RS05295 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 6 to 24 (19 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 9 to 333 (325 residues), 190.5 bits, see alignment E=1.8e-59 PF12831: FAD_oxidored" amino acids 10 to 114 (105 residues), 29.5 bits, see alignment E=2e-10 PF01134: GIDA" amino acids 10 to 54 (45 residues), 29.9 bits, see alignment 1.3e-10 PF13450: NAD_binding_8" amino acids 13 to 67 (55 residues), 26.6 bits, see alignment 2.4e-09 PF13738: Pyr_redox_3" amino acids 128 to 302 (175 residues), 33.4 bits, see alignment E=1.2e-11 PF00070: Pyr_redox" amino acids 176 to 245 (70 residues), 59.1 bits, see alignment E=2.1e-19 PF02852: Pyr_redox_dim" amino acids 353 to 474 (122 residues), 76 bits, see alignment E=1e-24

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 94% identity to rpf:Rpic12D_3419)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABZR87_RS05295 NAD(P)/FAD-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MPANPAHAFDLIVIGAGSAGLAAARRSAQLGARTLLIDRAQVGGTCVNRGCVPKKLLGYG
AAWSQTMARCLRAADTSHTSDAWADAIARTRAEVARLHEAHFAQLADAGVQWLSGMASLR
GRGIIRLQTESGKTTLRARQIVLAAGARPTPLPVPGAELACTSDDVFGCDALPASLIIAG
GGVVAVEMASTLARFGVRVTVLTRDARVLPEFDATVAEAASQSLAGCGVDLILNADVVRI
EHDAVNGGGVAVYASTEGSDAPRVLRAQRVMSAIGRAPNIAGLGLDAAGVTLDAHGRIAV
DRHFRTRARGVHAVGDVCGGSPLQLTPVAAAQGRYVAERLFGKGIKLPDMNTVPMAVFCD
PAIASVGLTEADARARWPELGKRGPDTDKRALADRIDVVVRRFVSLEQRFAGSGMESLIK
LVCNARSGRVLGAHIVDNAAPEIIQALAVAVRMGVRLKHLQSTVGLHPTVAEELLSM