Protein Info for ABZR87_RS05285 in Ralstonia sp. UNC404CL21Col

Annotation: D-2-hydroxyacid dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 19 to 331 (313 residues), 57.3 bits, E=2.1e-19
• PF02826: 2-Hacid_dh_C
  • amino acids 115 to 300 (186 residues), 175.7 bits, E=9.5e-56
• PF07991: IlvN
  • amino acids 155 to 219 (65 residues), 24.4 bits, E=2.9e-09

Best Hits

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 98% identity to rpf:Rpic12D_3417)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Protein Sequence (342 amino acids)

>ABZR87_RS05285 D-2-hydroxyacid dehydrogenase family protein (Ralstonia sp. UNC404CL21Col)
MKIAVLDDYQDAVRKLDCFSLLQDHEVKVFNNTVKGVGQLAARVADVEAIVLIRERTRVT
RQLLDRLPKLKIISQTGRVSRDSGGHIDLDACTDKGVVVLEGRGSPVAPAELTWALVMAA
QRRIPQYVASLKHGAWQQSGLKSTTMPPNFGIGRVLKGQTLGIFGYGKIGQLVAGYGRAF
GMNVLVWGREGSQERARADGFAVADSKEALFEQSDVLSVHLRLNDETRGIVTVADLTRMK
PTALFVNTSRAELVEENGLVTSLNRGRPGMAAIDVFETEPILQGHTLLRMENCICTPHIG
YVEREGYELYFSIAFQNILDVLQGNVDSVVNPTALAPALIRA