Protein Info for ABZR87_RS05230 in Ralstonia sp. UNC404CL21Col
Annotation: response regulator transcription factor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to NREC_STACT: Oxygen regulatory protein NreC (nreC) from Staphylococcus carnosus (strain TM300)
KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_3729)MetaCyc: 37% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"DNA-binding response regulator, LuxR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (214 amino acids)
>ABZR87_RS05230 response regulator transcription factor (Ralstonia sp. UNC404CL21Col) MNMRSPAPVKLLLVDDHPLVRDGVRVRLEAVPHFEVVGEAGDAEAALQAARTLSPDLALM DIGMRGMNGIALTEKFAEEFPEIAVLVLSMHDNLEYVRQVMRAGARGYVLKDAPASELVE AIDAVLAGRPFYSAQLAMRMAEQAVMPTPVEALTPRERDILDGIAKGYANKRIADELGLS VRTVESHRLNLKRKLGIEGQAELVKFAVELGKGR