Protein Info for ABZR87_RS05205 in Ralstonia sp. UNC404CL21Col

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07021: MetW
  • amino acids 21 to 208 (188 residues), 286.6 bits, E=2.2e-89
• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 21 to 208 (188 residues), 281 bits, E=2.2e-88
• PF13489: Methyltransf_23
  • amino acids 27 to 120 (94 residues), 34 bits, E=5.8e-12
• PF13847: Methyltransf_31
  • amino acids 33 to 125 (93 residues), 41.4 bits, E=3.1e-14
• PF13649: Methyltransf_25
  • amino acids 37 to 121 (85 residues), 33.3 bits, E=1.7e-11
• PF08241: Methyltransf_11
  • amino acids 38 to 122 (85 residues), 40.7 bits, E=7.9e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3724)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Protein Sequence (211 amino acids)

>ABZR87_RS05205 methionine biosynthesis protein MetW (Ralstonia sp. UNC404CL21Col)
MTTQTLNTAAPSAVPNILADRADFRAIARWIEPRSTVLDLGCADGSLLSVLQDELDVLAY
GIEIDDAGVLASTQKGVHVIQQNLEGGLALFEDKSFDTVILSQTLQTIHNTAQVLREMLR
VGRECIVSFPNFGYWPHRLSIFRGRMPVSESLPYEWYDTPNVRVLTIRDFEALAPKVGLV
ILDRVVLHEGNVVRWGANWRGSVAVYRVRAG