Protein Info for ABZR87_RS05180 in Ralstonia sp. UNC404CL21Col

Annotation: nucleoid occlusion factor SlmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00440: TetR_N" amino acids 53 to 81 (29 residues), 31.8 bits, see alignment 4.8e-12

Best Hits

Swiss-Prot: 49% identical to SLMA_MARMS: Nucleoid occlusion factor SlmA (slmA) from Marinomonas sp. (strain MWYL1)

KEGG orthology group: K05501, TetR/AcrR family transcriptional regulator (inferred from 99% identity to rpf:Rpic12D_3396)

Predicted SEED Role

"Transcriptional regulator SlmA, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>ABZR87_RS05180 nucleoid occlusion factor SlmA (Ralstonia sp. UNC404CL21Col)
MSNAQTEFPTAEPVADVAIEAPPVRKRPRPGERRVQILQTLAGMLEHPRGEKITTAGLAA
RLDVSEAALYRHFASKAQMFEGLIEFIEQTVFGLINQITLREEHGLRQAHAIAHMLLSFA
DKNPGMTRVLVGDALVGEDERLPERMAQCLDRIEASLKQSLRMAVTQGAWPADTDIASRA
NLLVCAVLGRWHRYAKSGFRKSPVEGADAQLRVLLA