Protein Info for ABZR87_RS05065 in Ralstonia sp. UNC404CL21Col

Annotation: tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF02899: Phage_int_SAM_1" amino acids 19 to 100 (82 residues), 62 bits, see alignment E=5.4e-21 TIGR02224: tyrosine recombinase XerC" amino acids 21 to 327 (307 residues), 352.2 bits, see alignment E=1.2e-109 PF00589: Phage_integrase" amino acids 127 to 313 (187 residues), 136.1 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 97% identical to XERC_RALPJ: Tyrosine recombinase XerC (xerC) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 97% identity to rpi:Rpic_3697)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ABZR87_RS05065 tyrosine recombinase XerC (Ralstonia sp. UNC404CL21Col)
MPQSASADASGAQAPHPQIAAYLDALKFERQLSPHTLESYTRELAVLQRLGAQHAAIVDL
TQLQSHHIRRMMAQLHGDGLSGRSIARALSAWRGWFKWMALRDAAVTANPVDGVRAPKSP
KRLPKALSVEQAVALMEQLPGDDAETVRDRAVNELFYSCGLRLSELVSLDMRHVKAGAYE
SASWLDLEAREVQVLGKGSKRRTVPVGTKAAEALAAWLAVREQLAKPDAAPEDAHALFLS
PRGKRLAQRQIQLRMKRNAIAAGVPADVHPHVLRHSFATHMLQSSGDLRAVQELLGHASI
ASTQVYTSLDFQHLAKIYDQAHPRAKKK