Protein Info for ABZR87_RS04940 in Ralstonia sp. UNC404CL21Col

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details PF00672: HAMP" amino acids 382 to 432 (51 residues), 39.8 bits, see alignment 1.2e-13 PF08448: PAS_4" amino acids 456 to 575 (120 residues), 24.9 bits, see alignment E=5.1e-09 PF00512: HisKA" amino acids 586 to 652 (67 residues), 38.1 bits, see alignment E=3.3e-13 PF02518: HATPase_c" amino acids 700 to 813 (114 residues), 62.4 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_3349)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (833 amino acids)

>ABZR87_RS04940 PAS domain-containing sensor histidine kinase (Ralstonia sp. UNC404CL21Col)
MIFDRSYKRLLYQVVAGTIVFLAIVLVGLLAAASANTEFFDRYFTLLYKVNLVIGVLLVV
IIGGLMLALALRARRGKFGTRLMTKLAVFFGVVGVLPGVLIYLVSLQFVSRSIESWFDVK
VESALEAGLNLGRSTMDTALADLQNKGRLIAEQVGDGSASATAITLNRLREQFGVQEATI
FTASGRVIATASNTYDTLVPNLPDQAVLEQARAPGGYASLEGGSDAETDSASAPAASAPS
APSAPAAPAAPRANGRRSDLYQLHVVVALGTASRDEPSLGLSTPARKWAGTGLLADRRPE
DGGGTSRGFGLIGESGRDERFLQLVQPVPQALARNADAVQRAYQEYQEKALGRTGLRKMY
IGTLTLTLFLAVFIAVMLALLLGAQLARPLLMLLQGTREVAEGDLSPKRELHTRDELGVL
TQQFNQMTRQLADARRAVEQNRAALEQSKAYLESVLTNLTAGVFVFDHRFVLLTANPGAE
RIFKQPFGAWVGQGLTSITPVAAFAPVVEQAFAEQDASTAAGGAVAHWQKQVEIPLEDED
EPLTLLVRGTRLPGPSVGAHGTERGYVVVFDDISDVISAQRSVAWGEVARRLAHEIKNPL
TPIQLSAERLEMKLSPKLSEADADVLRRGATTIVNQVAAMKRMVDDFRDYARTPPAMLQE
LDLNALAAEVLHLYGIDHPDRRDHPVIEAKLGANLPLIKGDPTQLRQVIHNLLQNAQDAV
AENEAAGRPAPHVMLQTDTVEYDDASGARRQAVRLAIADNGGGFSSRILNRAFEPYVTTK
AKGTGLGLAMVKKIMDEHGARIELRNRQSSTTSGTSGTDTVGAQVSILFVKLA