Protein Info for ABZR87_RS04805 in Ralstonia sp. UNC404CL21Col

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 183 to 361 (179 residues), 139.5 bits, E=3.9e-45

Best Hits

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 95% identity to rpi:Rpic_3646)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (384 amino acids)

>ABZR87_RS04805 thiamine phosphate synthase (Ralstonia sp. UNC404CL21Col)
MSASALRFSAAWPEAAALAAQIVDRHTEAFGRAPHAWSVTDRADEATSPATVLLTTDAAQ
AERARSAGAAVVLTAVEGDQRIDTVYDRLGMYRFTSAAQGDAFDARFVAIFGAALALAFE
PRDALCVARAWIAEGNADALAWPTQFDALPRVLEPALPCPTAADLAFALCPTQLGIYAVV
PDSDWVARLVALKVPTVQLRFKSDDAQAVVDQVRRAEAAARGSATRLFINDHWQVAMSVH
AQVPGSGIYGIHLGQEDIDDADLVAIRSAGLRLGISTHGFAEMLRVAPLNPSYLALGAVF
ATPTKTMPTVPQGLGRLFAYAAAMRTRVPAPPLVAIGGIDLAAMPRVLESGVGSVAVVRA
ITQAADVPAAVDALQATFAAHVRA