Protein Info for ABZR87_RS04690 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00892: EamA" amino acids 14 to 138 (125 residues), 30.2 bits, see alignment E=2.5e-11 amino acids 149 to 283 (135 residues), 50.8 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 92% identity to rpf:Rpic12D_3300)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ABZR87_RS04690 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MRSMQAALAGSGATVLFVLLWSSGAIFAEIGVQHVPAFAFLVGRFTLASLVLAGLGLRHG
RWWPAPGSRLKVAATGALLTGGYSICYLLALDRGLTPGLLATVLGVQPLLTLLVTERTWS
APRMAGLLLALGGLSLVVGGADAHQVPMAGLGYALAALLCMTVGAIGQKRLNQSPIDTLP
LQNAVSLVLCAAFAFALPAQSLPLAPSLPGIAALLWMGVVMSVGAQLLFYRLMQRGNLVN
VTSLFYLVPVVTALLDDLVLGHRLALLAMAGMAMILLGLAVAFRAAR