Protein Info for ABZR87_RS04620 in Ralstonia sp. UNC404CL21Col

Annotation: globin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 267 to 285 (19 residues), see Phobius details PF00042: Globin" amino acids 27 to 132 (106 residues), 52.9 bits, see alignment E=5.2e-18 PF00175: NAD_binding_1" amino acids 269 to 374 (106 residues), 43.5 bits, see alignment E=4.7e-15

Best Hits

Swiss-Prot: 41% identical to HMP_BACC1: Flavohemoprotein (hmp) from Bacillus cereus (strain ATCC 10987 / NRS 248)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 95% identity to rpi:Rpic_3609)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>ABZR87_RS04620 globin domain-containing protein (Ralstonia sp. UNC404CL21Col)
MLSDQSKPYIDASVPVLREHGLTITQTFYRNMFASHPQLTNLFNMGNQANGSQQQSLASA
VFAYAANHGDNGALAPVVNRIVHKHAAVGIKPSHYPIVARHLLGAIAEVLGDAATPDLLA
AWDEAYWLLAAELIAAEARLYQYTGSGPDHRQPVRIVSRRQQAEDVVSLTLEAVGDAPLA
AFLPGQYISVQVELAPGVLQQRQYSLSDAPNGRTWRISVKRDAGDADRPAGTVSSWLHAN
AREGDVLLVSQPYGDFVPQLATHNPIVLMSAGVGITPMISALNALAQENSARKIVFSHAA
RAASHVAHTDDLERAAQALPAFEAHVFLESGEDVEFASRPARPGRMTVDTFVRDNAADAD
FYLCGPLPFMQAQRAALLASGVPSERIHREVFGPDLLDDIL