Protein Info for ABZR87_RS04605 in Ralstonia sp. UNC404CL21Col

Annotation: DUF2795 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11387: DUF2795
  • amino acids 77 to 120 (44 residues), 59.9 bits, E=1e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to rpi:Rpic_3607)

Predicted SEED Role

"Tryptophan synthase beta chain like (EC 4.2.1.20)" (EC 4.2.1.20)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• DIBOA-glucoside biosynthesis (1/6 steps found)
• superpathway of benzoxazinoid glucosides biosynthesis (1/13 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Protein Sequence (128 amino acids)

>ABZR87_RS04605 DUF2795 domain-containing protein (Ralstonia sp. UNC404CL21Col)
MKPTRDKSKHASHSKSTSQSNRSSASAKERGGHASQGSGGKSSERAGAKSHERGAHGGGG
GGSEHATHSPIGIQKALKGASYPAKKQELLKTAQANGADDSTLKTLRDMPDDEYDTPAAV
SKAVSNEK