Protein Info for ABZR87_RS04545 in Ralstonia sp. UNC404CL21Col

Annotation: aquaporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF00230: MIP" amino acids 19 to 125 (107 residues), 63.6 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 90% identity to rpi:Rpic_3596)

MetaCyc: 49% identical to aquaglyceroporin (Sinorhizobium meliloti)
TRANS-RXN0-551

Predicted SEED Role

"major intrinsic protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABZR87_RS04545 aquaporin (Ralstonia sp. UNC404CL21Col)
MATVSHLRTAASAPSAAPSLARRIVAEGLGTALLIAVVIGTGIHASRLSGGDATWTLLAQ
SLAGGAGLLALLTVFTPVSGAHLNPAVTLSAWLRGGLRGHAALAYLAAQVVGAALGVAAA
HAMFGMPAWAPGTHAATGPALWWSEALATFGLIGVGIACGRHAPKQLPLVVAAYIAAGYW
FTASSSLANPALAFACALTDGPSGIRPGDVPGYMLAQLLGAMLATPVFNWLMGAQAWPAQ
ASDTGIAPTQAVPMPRRAG