Protein Info for ABZR87_RS04530 in Ralstonia sp. UNC404CL21Col

Annotation: MetQ/NlpA family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00363: lipoprotein, YaeC family" amino acids 14 to 266 (253 residues), 278.5 bits, see alignment E=3e-87 PF03180: Lipoprotein_9" amino acids 30 to 268 (239 residues), 310.4 bits, see alignment E=3.1e-97

Best Hits

Swiss-Prot: 49% identical to PLPC_MANHA: Outer membrane lipoprotein 3 (plpC) from Mannheimia haemolytica

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 99% identity to rpf:Rpic12D_3271)

MetaCyc: 53% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ABZR87_RS04530 MetQ/NlpA family lipoprotein (Ralstonia sp. UNC404CL21Col)
MSLFSRLARVAVPAIAFAVATAANADTKQIKLGTMSGPDAQIWEVVQKVAKKDGLDVKII
EFNDYAQPNPALDSGDLDANGFQHQPFLDSQIQARHYKIVNVGLTYVAPMGFYSKKVKSL
AQLKEGAKVGIQNDPSNGNRALLLLQKAGVIKLKAGAGTNGNNATPRDVVENPKKIKLIE
LDSAQLPRSLDDLDAASINTDYAVKNGLTPTKDAIALEDRQGPYANLIAVREKDKNQPWV
KTLVRAYQSEDVRKFIDTQFKGAILPAF