Protein Info for ABZR87_RS04510 in Ralstonia sp. UNC404CL21Col

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 64 to 82 (19 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details amino acids 513 to 537 (25 residues), see Phobius details amino acids 558 to 581 (24 residues), see Phobius details PF03814: KdpA" amino acids 10 to 588 (579 residues), 827.6 bits, see alignment E=2e-253 TIGR00680: K+-transporting ATPase, A subunit" amino acids 240 to 589 (350 residues), 552.1 bits, see alignment E=7.2e-170

Best Hits

Swiss-Prot: 97% identical to KDPA_RALPJ: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 97% identity to rpi:Rpic_3589)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>ABZR87_RS04510 potassium-transporting ATPase subunit KdpA (Ralstonia sp. UNC404CL21Col)
MNAFLLQLAIYLVVLLVLAKPLGAYMTGVFGDKPSRAHWLGPVERLFYRVAGVNPQAEMG
WKRYALAVIVVNVLGALAVYALQRVQQWLPLNPQGFGAITPDSSFNTAISFVSNTNWQGY
SGESTMSYLTQMLGLAVQNFLSAATGIAVVIALIRGFARHSANTIGNFWVDFTRATVYVL
LPLSILVSVFFVSQGVIQNFDGYKEVTTVTATTYDNPKMDASGQPLKDAQGNPVTEKATT
QTQTLPMGPVASQEAIKMLGTNGGGFFNANSAHPYENPNALTNFVQMLAIFIIPAALCFT
FGGMVGDGRQGWAVLAAMTVLFAVLAVFLAWAELHANPMLANLGIDQAMGNMEGKETRFG
IVASSLFATITTAASCGAVNAMHDSLTALGGFVPMFLMQLGEVVFGGVGSGLYGMLVYAI
LAVFIAGLMIGRTPEYLGKKIEVFEMKMTSIAILVTPLLVLVGTAIAVVVTQGKAGIFNP
GTHGFSEVLYAFSSAANNNGSAFAGLSANTPFYNIALGIAMWLGRFWIIVPVLAMAGTFA
AKKRLPVTAGTLPTHGPLFVVLLIGSVLLVGALTYIPALALGPIAEHLAR