Protein Info for ABZR87_RS04450 in Ralstonia sp. UNC404CL21Col

Annotation: MIP/aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details amino acids 30 to 30 (1 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details PF00230: MIP" amino acids 6 to 158 (153 residues), 57.9 bits, see alignment E=6.7e-20

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_3256)

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>ABZR87_RS04450 MIP/aquaporin family protein (Ralstonia sp. UNC404CL21Col)
MVELRSRLTAEALGTALLLAIVIGSGIMAERLSGGNAAIALLANTAATVGGLYVLIEILG
PISGAHFNPVVSAVMAARGELPGAALLPYIVAQMLGAVLGAWLTHAMFDMTLLQFSTKVR
SGTGQWIAEAVATAGLLLVILRAPNGRAASMVAAYIGAAYWFTASTSFANPAAAFGRMFS
NSFAGIAPGSVPGFVLAECAGAVLGVLLHNLLEPRFAASGHPNVIESSGEHPPQA