Protein Info for ABZR87_RS04380 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details amino acids 431 to 452 (22 residues), see Phobius details amino acids 459 to 483 (25 residues), see Phobius details amino acids 504 to 525 (22 residues), see Phobius details amino acids 562 to 581 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 271 (169 residues), 56.6 bits, see alignment E=1.4e-19 amino acids 409 to 575 (167 residues), 45.5 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to rpi:Rpic_3569)

Predicted SEED Role

"ABC-type anion transport system, duplicated permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>ABZR87_RS04380 ABC transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MQQNDNETTIRGRLGTTFGTNLGVNFGNLLTAPPNRFDLALLPIILAAIVLVAYAAKQMN
VPYTPGEHLDVSLDVIELPYYLLRTSIRMLLALGASLAFSFAFAAIASKNRTAEKVMVPA
LDILQSIPVLGFLSITVTGFIALFPGNLVGVECAAIFAIFTSQAWNMAFSLYQSFRTIPT
DLEEAATVFRLSKWQRFWRLEVPFAMPGLLWNMMMSMSGGWFFVVASEAISVSGHDIKLP
GIGSYISLAIQQQNLPAIGWAILAMLIGIILYDQLLFRPLIAWADRFRFDSMSSEREPQS
WLLDLLRRSEWVKALLERTAALAERTLSWGAERTRPTAAPGNGFLPRFPWSHRIADVVII
LAALMAVAHVLQFVRSEVGWAEVGHVFWLGFLTMVRVILLIALAALVWVPIGIRIGLNPN
VARIAQPVAQFLAAFPANLMFPLAVMLIARFALNPEIWLSPLMIFGTQWYILFNVIAGAS
AIPTELKLAARNFGLRGWLLWKRFLIPAVFPNLLTGLVTAAGGSWNASIVSEYVSWGDRT
LVATGLGSYIAEMTAKGDFPRIALGIAVMSLFVVGFNRLLWNRLYDIAQERTRL