Protein Info for ABZR87_RS04285 in Ralstonia sp. UNC404CL21Col

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 39 to 157 (119 residues), 61.2 bits, see alignment E=1.7e-20 PF00512: HisKA" amino acids 310 to 375 (66 residues), 47 bits, see alignment E=3.3e-16 PF02518: HATPase_c" amino acids 435 to 552 (118 residues), 85.1 bits, see alignment E=6.9e-28

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_3229)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>ABZR87_RS04285 sensor histidine kinase (Ralstonia sp. UNC404CL21Col)
MFKRHRPASSSASAAPAKGGNGAISLRLHLLRALATPLFGLIVGTGALSYWLAAHYTAQV
FDRALVGVANTLAEQLRIAGPHVPAAKLYDIALTAQTLVQNSGEDRIYWRISGPTGTLVG
RDTPLGYGSGQVRIGDARVFYSWIDGKQVRAVHLLVPGVSAEVPKPRSPRQPVQPDPEDD
VTRPALAPTQSQTAPAFNPSNPPDAMQAEGGIVVEVAELLDHRDTAAKEVLLSVSIPLIV
LLAIGGLILSLVLKEELQPLQTLADTLNKQSARSVTPLPAESAERVPAELQPLINAMNAL
LARLRDALEAQRTFIADAAHQLRTPLTALKLHADRAVDAKTLDDARPALLELQSGANRAV
RLSNQLLTLARAEPGMTLDQLGPPMRVDLVSLAFDTGAEWVPRALARGLDLGFEAWPQEA
ASPGSLQAPVLANVVLLREAVNNLLDNAIKYVPAGGRVTLRAGMEADAASRWWGVVSVED
NGPGIPPERRGEVFQRFFRGDADHRPGQPQGSGLGLAIVHDIVRLHGGTVAIDDATARDG
SRVMRFVLRLPLASESV