Protein Info for ABZR87_RS04180 in Ralstonia sp. UNC404CL21Col

Annotation: TSUP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 68 to 92 (25 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 136 to 165 (30 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details PF01925: TauE" amino acids 6 to 244 (239 residues), 167.8 bits, see alignment E=1.7e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 99% identity to rpf:Rpic12D_3206)

Predicted SEED Role

"conserved hypothetical transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>ABZR87_RS04180 TSUP family transporter (Ralstonia sp. UNC404CL21Col)
MEFALLAVAGFLAGLIDAVAGGGGLVQIPALFSAYPNIAPATLIGTNKVASMSGTATAAV
RYGRTVRIYWGATAPAVVTAFVFSLLGAWALTHIPAEPLRRALPFVLAVLLVYTVAKKNL
GADHAPSLKGWRERAAALLAGAAIGFYDGVFGPGTGSFLMIVFVRVFGYDFLHASASTKI
VNLATNVAALLLLAAKGHVWWQLGLVMAVANVAGNQVGSHLALRHGSRFVRKVFIVVVLA
LILKTAYDAFIR