Protein Info for ABZR87_RS04035 in Ralstonia sp. UNC404CL21Col

Annotation: phosphate ABC transporter substrate-binding protein PstS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12849: PBP_like_2" amino acids 21 to 247 (227 residues), 116 bits, see alignment E=1.3e-37 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 24 to 327 (304 residues), 300 bits, see alignment E=9.2e-94

Best Hits

Swiss-Prot: 41% identical to PSTS_XYLFT: Phosphate-binding protein PstS (pstS) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 98% identity to rpf:Rpic12D_3180)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ABZR87_RS04035 phosphate ABC transporter substrate-binding protein PstS (Ralstonia sp. UNC404CL21Col)
MFKHVVFALAVAAAGMPVLARAEVHGAGSTAAAPVYRVWAAGYAASSGVTLSYDAVGSGE
GLKRIRAGAVDFGASDVPLSSAEAAKAGLVCVPSVVTGAVPFVNVPGVPRGQLKLTGELL
AQIFLGKVESWDAPELRALNPGVTLPKLKIHPVVRADGSGTTYHFTDYLSAVSADWKSAY
GTKSTINWPAGFTAAKGSGDVVKAVQATPGAIGYVDYNYILDNDLSGVQLRNVAGRFVSA
QVSGFREAVMQSAWNRKGDFTAPLVNLPGAETWPITMGTFIVVPAVSASGPRTLAALKFL
TWGYFHGDELAARAKFVPLPERVQAIAYRELARVTDTSGAAIGLQSMPANWGK