Protein Info for ABZR87_RS03980 in Ralstonia sp. UNC404CL21Col

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 6 to 354 (349 residues), 445.9 bits, E=4.9e-138
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 10 to 354 (345 residues), 412.3 bits, E=7.3e-128

Best Hits

Swiss-Prot: 97% identical to DCUP_RALPJ: Uroporphyrinogen decarboxylase (hemE) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 97% identity to rpf:Rpic12D_3174)

MetaCyc: 60% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis II (oxygen-independent) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (2/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Protein Sequence (364 amino acids)

>ABZR87_RS03980 uroporphyrinogen decarboxylase (Ralstonia sp. UNC404CL21Col)
MSAPLANDTFLRALRRQPTDYTPLWLMRQAGRYLPEYNATRARAGSFLGLAKSPAYATEV
TLQPLDRYPLDAAILFSDILTVPDAMGLGLSFAQGEGPRFAKPVRTEADVAALSVPDMSS
LQYVFDAVAEIRRALVQDGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMLYARPD
LMHRILEINAQAVIDYLNAQIDAGAQAVQIFDTWGGALADGIYHEFSLAYMARVVQGIRA
GADGQRVPVILFTKGGGLWLEAMAETGADALGVDWTVNLQRARQRTAGRVALQGNLDPTV
LFAEPEAIRAQARRVLEDYAAGGGSDGHIFNLGHGISQFTPPDAVSVLVDEVHSFSRAQR
SKAK