Protein Info for ABZR87_RS03960 in Ralstonia sp. UNC404CL21Col

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 252 to 253 (2 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 23 to 350 (328 residues), 93.5 bits, see alignment E=6.5e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_3169)

Predicted SEED Role

"Kef-type K+ transport systems, membrane components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABZR87_RS03960 cation:proton antiporter (Ralstonia sp. UNC404CL21Col)
MSAMTGLHDLFPSWPPAPGGLFWIGLALVGAALCGEFARAALKLPRIVGYAVAGLVAGVL
GRPLIDTDMLEQTHILIEMALALALFELGHRLSFEWLRANRWLLLTSGFESLLTWGLVTW
VLQLFGVATPVAVAAGAIAVATSPTVLLQLKNELRAEGQVTERLLSLGALNSIYASVLVP
LTAGWLHSEYGHWAAALIHPLYLLAGSVLLAWVVGKVGHALYHRMAGDDHYAFLVLVGLV
LFALAMAKLLKLSVPLTLLLAGVVFKHQDDHPRVWPSHFGSAGSILIVVMIVSLGLPLKA
SDWAIGGVAAVALVLSRFIAKLAATTALGSFSGLSMRQSIALGLALGPMSGLSWLLMHDT
AALYPQTGGPLAAIILCTLAIQQIAAPILTARSLRWAGEVRQDNEHR