Protein Info for ABZR87_RS03950 in Ralstonia sp. UNC404CL21Col

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 2 to 137 (136 residues), 61 bits, E=6.2e-20
• PF13420: Acetyltransf_4
  • amino acids 3 to 155 (153 residues), 40.9 bits, E=6.7e-14
• PF00583: Acetyltransf_1
  • amino acids 31 to 136 (106 residues), 64.3 bits, E=3.9e-21
• PF13673: Acetyltransf_10
  • amino acids 47 to 144 (98 residues), 36.8 bits, E=1.1e-12
• PF13508: Acetyltransf_7
  • amino acids 51 to 138 (88 residues), 44.3 bits, E=5.6e-15
• PF08445: FR47
  • amino acids 84 to 138 (55 residues), 35 bits, E=3.5e-12

Best Hits

Swiss-Prot: 60% identical to MDDA_PSEAE: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (pitA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 99% identity to rpi:Rpic_3492)

MetaCyc: 47% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1, 2.3.1.183

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Protein Sequence (171 amino acids)

>ABZR87_RS03950 GNAT family N-acetyltransferase (Ralstonia sp. UNC404CL21Col)
MLLRDATQADLPAILAIYNDVIANSNAIYTETPVTLEDRTAWLALRATQGYPVLVADDDG
QVAGVASFGDFRPYPGFRTTVEHSVHIHRDWRGKGLGSLLVEALCERAAALGKHLMVGAI
DGANAGSIRLHEKLGFKEVGRMPEAAIKRGQWLDLVFMQRWLEAPGTVRSD