Protein Info for ABZR87_RS03945 in Ralstonia sp. UNC404CL21Col

Annotation: oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details amino acids 469 to 489 (21 residues), see Phobius details amino acids 506 to 526 (21 residues), see Phobius details amino acids 533 to 552 (20 residues), see Phobius details amino acids 564 to 590 (27 residues), see Phobius details amino acids 617 to 638 (22 residues), see Phobius details amino acids 658 to 678 (21 residues), see Phobius details TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 14 to 635 (622 residues), 359.2 bits, see alignment E=4.9e-111 PF03169: OPT" amino acids 17 to 636 (620 residues), 352.9 bits, see alignment E=2.1e-109 TIGR00733: oligopeptide transporter, OPT family" amino acids 17 to 638 (622 residues), 687.4 bits, see alignment E=1.6e-210

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3491)

Predicted SEED Role

"oligopeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>ABZR87_RS03945 oligopeptide transporter, OPT family (Ralstonia sp. UNC404CL21Col)
MQSLHPPKHIPAATLPELTLRGMILGAIITVIFTASNVYLGLKVGLTFSSAIPAAVISMA
VLRMLGGTNILENNMVQTQASAAGTLSSIIFILPGLVMIGHWQGFPFWQTFGVCMAGGML
GVVFTIPLRHAMVVQSDLPYPEGVAAAEILRVGSGQSADGENAVDDDAVPAATGMRDLAA
GGIVAAIVAFATSGLRLLGEGASWWFAAGAAVVRLPLGFSTALLGAGYLIGLVAGLAMLV
GLVIAWGIAVPYLTSITPMPAGKALSAFGTDVWRTQVRFIGAGVIAVAAVWTLGTLIGPV
VQGVKRSFGSLRPKTDSALRTEQDMAPRWILLVTLAMVVVLVITFAAFLAPTMLSAGSRW
TLITCAVIFAVVFGFLVAAACGYMAGLIGSSSSPISGIGIIAITLVSLLLLAIGADNGIV
GSPEASKLGIALAIFTTSAVVAVATISNDNLQDLKTGWLVGATPWRQQVALLIGCVAGAA
VISPVLELLYNAYGFPGALPRAGMDAAQALSAPQATLMTAIATGIFTHQLEWNMVIAGIV
IGVLLIAVDWALKQRGGVARLPVLAVGIGIYLPPTVSTVLVTGAVLAWIIEKLLAKRARA
AGVPYERYAEVPNRHGVLLASGLIVGESLVGVLMAAVIGGTGKDAPLAIVGASFEGTAQW
LGLIVFALVCWAFARRVLAVRPTH