Protein Info for ABZR87_RS03940 in Ralstonia sp. UNC404CL21Col

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to SDHL_STRCO: L-serine dehydratase (sdaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 98% identity to rpf:Rpic12D_3164)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
D-serine degradation (3/3 steps found)
L-serine degradation (3/3 steps found)
glycine degradation (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
L-cysteine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
glycine betaine degradation I (5/8 steps found)
glycine betaine degradation III (4/7 steps found)
purine nucleobases degradation II (anaerobic) (16/24 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>ABZR87_RS03940 L-serine ammonia-lyase (Ralstonia sp. UNC404CL21Col)
MAVSVFDLFKIGIGPSSSHTVGPMRAALMFASGLEADGLMSQVASVRVELYGSLGATGKG
HGTDRGVILGLMGEAPDTIDPDTIEDKLAALRASQSLSLLGRHAVRFTEKEHIAFYRREA
MAEHPNGMKFHAFDAAGERLREARYLSVGGGFVVTAGAPNTQVLAAHDQLPHPFRSGKEL
LAMCESTGKSIARLMLENELTWRTEAEVRAGLLNIWHVMQACVARGCRTEGELPGPFHVR
RRAAELYSRLTVQAERTLSDPLSVIDWVNLYAIAVNEENAAGGRVVTAPTNGAAGIIPAV
MHYYDRFVPAANDNGIVDFLLTAGAIGMLYKMNASISGAEVGCQGEVGVACSMAAGALAA
VLGGTPAQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNAMASVKAVNAARMALRGDGT
HYVSLDSVIKTMRETGADMKTKYKETARGGLAVNIVEC