Protein Info for ABZR87_RS03900 in Ralstonia sp. UNC404CL21Col

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13660: DUF4147
  • amino acids 24 to 247 (224 residues), 298.1 bits, E=4.2e-93
• PF05161: MOFRL
  • amino acids 326 to 431 (106 residues), 134.2 bits, E=2e-43

Best Hits

Swiss-Prot: 56% identical to TTUD4_AGRVI: Putative hydroxypyruvate reductase (ttuD) from Agrobacterium vitis

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 98% identity to rpi:Rpic_3481)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• L-serine biosynthesis II (1/4 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Protein Sequence (439 amino acids)

>ABZR87_RS03900 glycerate kinase (Ralstonia sp. UNC404CL21Col)
MHHDQSAQAALRAALPNPSPRALLHGLFDTAVAAVSAAQCLPAFLPEPPRGRTIVIGAGK
GAAAMAEAVEQHWKGELSGLVVTRYEHGRAPGTQGRIEVVEASHPVPDAAGQHAAQRMVG
LLEGLTEDDLVLCLISGGGSALLAAPAEGLTLADKQSVNRALLKSGASIGEMNCVRKHLS
SIKGGRLALACAPARVETLLISDIPGDDPTLIASGPTLPDATTCADALAVIDKYGIDVPE
AVRRHLETGAGETPKPGDARFEGHRSHVIATAQHALEAAAAQARALGYEAHILSDSIEGE
ARDVAEVHAGIVRQIVARNQPFTKPCVILSGGETTVTVRGNGRGGRNAEFLLALGVALDG
LPGVHAIACDTDGIDGSEDNAGAILTPDSLARAEALGLKPKQLLDNNDGYGFFDALGDLI
VTGPTRTNVNDFRAILITA