Protein Info for ABZR87_RS03900 in Ralstonia sp. UNC404CL21Col

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF13660: DUF4147" amino acids 24 to 247 (224 residues), 298.1 bits, see alignment E=4.2e-93 PF05161: MOFRL" amino acids 326 to 431 (106 residues), 134.2 bits, see alignment E=2e-43

Best Hits

Swiss-Prot: 56% identical to TTUD4_AGRVI: Putative hydroxypyruvate reductase (ttuD) from Agrobacterium vitis

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 98% identity to rpi:Rpic_3481)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABZR87_RS03900 glycerate kinase (Ralstonia sp. UNC404CL21Col)
MHHDQSAQAALRAALPNPSPRALLHGLFDTAVAAVSAAQCLPAFLPEPPRGRTIVIGAGK
GAAAMAEAVEQHWKGELSGLVVTRYEHGRAPGTQGRIEVVEASHPVPDAAGQHAAQRMVG
LLEGLTEDDLVLCLISGGGSALLAAPAEGLTLADKQSVNRALLKSGASIGEMNCVRKHLS
SIKGGRLALACAPARVETLLISDIPGDDPTLIASGPTLPDATTCADALAVIDKYGIDVPE
AVRRHLETGAGETPKPGDARFEGHRSHVIATAQHALEAAAAQARALGYEAHILSDSIEGE
ARDVAEVHAGIVRQIVARNQPFTKPCVILSGGETTVTVRGNGRGGRNAEFLLALGVALDG
LPGVHAIACDTDGIDGSEDNAGAILTPDSLARAEALGLKPKQLLDNNDGYGFFDALGDLI
VTGPTRTNVNDFRAILITA