Protein Info for ABZR87_RS03855 in Ralstonia sp. UNC404CL21Col

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02961: allantoicase
  • amino acids 17 to 333 (317 residues), 463.1 bits, E=1.8e-143
• PF03561: Allantoicase
  • amino acids 26 to 172 (147 residues), 172.9 bits, E=2.1e-55
  • amino acids 193 to 334 (142 residues), 161.9 bits, E=5.3e-52

Best Hits

Swiss-Prot: 98% identical to ALLC_RALPJ: Probable allantoicase (alc) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 98% identity to rpi:Rpic_3472)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

• allantoin degradation to glyoxylate I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (1/2 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Protein Sequence (336 amino acids)

>ABZR87_RS03855 allantoicase (Ralstonia sp. UNC404CL21Col)
MAMPTLDPNAPDFTRRYPNLADRRLGAEATFATDEFFAPKDRMLNPEPAVFIPGKYDDHG
KWMDGWETRRRRNGGYDHCIVRLARPGVVKGVDIDTSHFTGNFPPAASIEAAYLPDGEPT
EATLWTEIVPSTTLQGNSHAYVAVTSPQAFTHLRLNIFPDGGIARLRVYGQPQVDWKGAD
RTKLFDLAAMENGAYVVEANNEHFGPASRMLMPGRGVNMGDGWETRRRREPGNDWCVIAL
ANPGRIRKIEVDTAHFKGNFADRVSIQAARVVGGTDSSLKTQAMFWQTLLPEQKLQMDLQ
HYYEAEIADLGIVTHVRFNMFPDGGVSRLRLWGVLE